Protein Info for TX73_020455 in Rhodopseudomonas palustris CGA009

Annotation: O-antigen ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 108 to 125 (18 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 230 to 271 (42 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 322 to 347 (26 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details PF04932: Wzy_C" amino acids 213 to 338 (126 residues), 51.4 bits, see alignment E=5.5e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA3948)

Predicted SEED Role

"FIG01006796: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>TX73_020455 O-antigen ligase family protein (Rhodopseudomonas palustris CGA009)
MVSFVAHSSPSHSVFDRSRAWLLAVKAPERLFVLVMCLMYVLHNIWLARTILWFLVLPTL
LIAALPPRTLAPIIKSGVFVASAAFLGVIIVTSLFGEGVSGSLLWKNIRYVAAVLVFITI
VAHLASRDGDFLRLLFLWLAPVAALAAIRDVGTFSHWSVSEMLTVRLQGTKGLSLYYNSN
VVGLMYAMPCVGAVAMMATRRLRSWQFVLLFVSALVLLAAVLLSGSRGSLMAALGGIGVA
VLLAANWRIAVAVAALLAIAAVAALLTPLAGELVQRKDSLRFELWPVYLHMVTLKPWLGY
GLAFDTRVTLPNGIEVMNGHNIFMCAAVRGGVVAALALAAVVLAAAASGWRAFRQSGEVT
ALALLAACLAASAVDYEIIPSDLSYLYILFWLPVAICLGTALATVRVPDPRPDTLPADIA
VS