Protein Info for TX73_020380 in Rhodopseudomonas palustris CGA009

Annotation: flagellar hook-basal body complex protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 598 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR03506: flagellar hook-basal body protein" amino acids 6 to 295 (290 residues), 138 bits, see alignment E=3.1e-44 amino acids 359 to 579 (221 residues), 121.9 bits, see alignment E=2.6e-39 PF06429: Flg_bbr_C" amino acids 525 to 595 (71 residues), 54.8 bits, see alignment E=4e-19

Best Hits

KEGG orthology group: K02390, flagellar hook protein FlgE (inferred from 100% identity to rpt:Rpal_4455)

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (598 amino acids)

>TX73_020380 flagellar hook-basal body complex protein (Rhodopseudomonas palustris CGA009)
MGIFGALTTSVAGLRSNSYALENISGNIANSQTTAFKRIDTSFLDLIPQAGNNQQLAGSV
TAGSRLTNTTQGSVQSASVSTYMAINGEGFFVVQKPSSFSDNNPIFPGVDNFTRRGDFSL
DKNGYLVNGAGYYLEGVKIDPTTGNPVGGSPGVLKFQNDFLPSQATTKISYRANLASYPL
TTKHDKSIPGSELLRAADFATNPQVLGTTPPPFSDNSKTGLQINNKQGVPITGATKLSGV
AGSDSIGVDFAVGNTITVNGTAITFTASGGTDDATHIPIDSTIANLLSKIDAISAGGAAS
TVTSGAVVLHTGVASDLAMTSGAAAFASLGLTSPVNVVRNGGGSVGTGKVTGVDNQTFLD
ESVSGGSTTAYDGNGAPVNVQFRWAKVDSATLGTGHTDVWNLFYQVNPNATGTQTAWQNV
NTNFTFASNGQMSPVIGQITLTGLTVSGVSLGDVTMAFGTGGLTQFSDTNGNVQVNQLQQ
DGYSAGQLVSVSVSNDGRVVGAYSNGRNIDLAEVSVATFNGANFLKRTDGGAFEITNESG
QPLYGKGGSVSGSSLESSNTDIADEFTKLIVTQQAYSANTKVITTANTMVQDLLNVMR