Protein Info for TX73_020170 in Rhodopseudomonas palustris CGA009

Annotation: flagellar type III secretion system pore protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 49 to 81 (33 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details PF00813: FliP" amino acids 54 to 246 (193 residues), 269.1 bits, see alignment E=1.3e-84 TIGR01103: flagellar biosynthetic protein FliP" amino acids 54 to 250 (197 residues), 291.5 bits, see alignment E=1.6e-91

Best Hits

Swiss-Prot: 62% identical to FLIP_CAUVC: Flagellar biosynthetic protein FliP (fliP) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 100% identity to rpt:Rpal_4413)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>TX73_020170 flagellar type III secretion system pore protein FliP (Rhodopseudomonas palustris CGA009)
MSASTGPRRVFISSSVLIIAVLAMIAPAQAQDISINLGGNSPGVTERAIQLIALLTVLSI
APSILVMMTSFTRIVVVLSLLRTALGTATAPPNAVIIALALFLTAFVMGPTLQKSYDEGI
KPLIANEIGVDDAMVRASGPLRIFMQKNVREKDLKLFLDLSGEPPPATPEDLSLRILMPA
FLISELKRAFEIGFLLFLPFLIIDLVVASILMSMGMMMLPPVVVSLPFKLIFFVLVDGWS
LVAGSLVQSYTGGG