Protein Info for TX73_020150 in Rhodopseudomonas palustris CGA009

Annotation: flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 PF02049: FliE" amino acids 21 to 101 (81 residues), 75.3 bits, see alignment E=1.8e-25

Best Hits

Swiss-Prot: 70% identical to FLIE1_BRADU: Flagellar hook-basal body complex protein FliE 1 (fliE1) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 100% identity to rpa:RPA3886)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (101 amino acids)

>TX73_020150 flagellar hook-basal body complex protein FliE (Rhodopseudomonas palustris CGA009)
MASPISAANAYASLARLAKPAGADKGGEDAPSFGNLVKQAMGSVLDAGRKSDAQSMAMAS
GKSNVMDVVTAVAETDVAVSTLVSVRDRVIQSYEEIMRMPI