Protein Info for TX73_019910 in Rhodopseudomonas palustris CGA009

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 652 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 267 to 294 (28 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 342 to 367 (26 residues), see Phobius details PF01594: AI-2E_transport" amino acids 22 to 121 (100 residues), 53 bits, see alignment E=1.5e-18 amino acids 173 to 366 (194 residues), 110.8 bits, see alignment E=4.2e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA3845)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (652 amino acids)

>TX73_019910 AI-2E family transporter (Rhodopseudomonas palustris CGA009)
MKLGKAQSLEDVAGLVGACAVTILAVIIISALYVGREVFVPVALAILLSFVLARPVNFLQ
SLRVPRAIAAISTVLFAFAVIFALGSLIATQLSRLADDLPQYQSTIQSKITSLRGVTGGS
TTLERAEGMLQNLSKELNKPKNAPAPSLSNPPTSSSRPVTPVPVEVLQPDPGTLANLRSL
IAPLISPLATTGIIVIFVIFILLQREDLRNRLIRLAGTRDLQRTTAALDDAASRLSRLFL
NQLLINSGFGVLIGTGLWIIGVPSPALWGILAAVLRFVPYIGSIISAAFPLTLAVAVDPG
WSMLVWTAILFFVIEPAIAHVVEPMVYGRSTGLSPVAVVISATFWTALWGPIGLVLATPL
TVCLVVLGRHVERLAFLDVMFGDRPALSPPEIFYQRMLAGDPAEAAEKAEQFLKERSLSS
YYDDVALKGLQLAQADLDRDALDAVRLTRIKETVQEFTEDLTDEIDQAPDGDEATTDAEA
AAAVEVTPVDHADDDIAVLKPADLKPGWQGAAPVMCIGGRSQLDEAAALMLAHLCRVHGI
GARVEPSSALSTKNIFGLDVSNVALICLSYLEASNTTHIRYAVRRLRRKAPHAKIIVALW
SAETPQLADTNESAQADATVLTLRDAVKYCVEEAIIEPPPQTIEMPVISEAV