Protein Info for TX73_019780 in Rhodopseudomonas palustris CGA009

Annotation: phosphoribosylaminoimidazolesuccinocarboxamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00081: phosphoribosylaminoimidazolesuccinocarboxamide synthase
  • amino acids 5 to 238 (234 residues), 222.8 bits, E=3e-70
• PF01259: SAICAR_synt
  • amino acids 7 to 235 (229 residues), 275.7 bits, E=1.8e-86

Best Hits

Swiss-Prot: 99% identical to PUR71_BRADU: Phosphoribosylaminoimidazole-succinocarboxamide synthase A (purC1) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 98% identity to rpc:RPC_1584)

MetaCyc: 42% identical to phosphoribosylaminoimidazole-succinocarboxamide synthase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylaminoimidazolesuccinocarboxamide synthase. [EC: 6.3.2.6]

Predicted SEED Role

"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.6

Use Curated BLAST to search for 6.3.2.6

Protein Sequence (255 amino acids)

>TX73_019780 phosphoribosylaminoimidazolesuccinocarboxamide synthase (Rhodopseudomonas palustris CGA009)
MSRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAFNAKKHQVIEGKGVLNNRISEYLFQH
LNDIGVPTHFIRRLNMREQLIREVEIVPLEVVVRNVAAGSLSQRLGIEEGTQLPRSIIEF
YYKNDQLNDPMVSEEHITAFGWATPQEIDDIMALAIRVNDFLTGLFLGIGIRLVDFKMEC
GRLFESEMMRIIVADEISPDSCRLWDIKSNEKLDKDRFRRDLGGLLEAYTEVAKRLGILM
ENERPIGSGPVLVKG