Protein Info for TX73_019775 in Rhodopseudomonas palustris CGA009

Annotation: phosphoribosylformylglycinamidine synthase subunit PurS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00302: phosphoribosylformylglycinamidine synthase, purS protein
  • amino acids 1 to 79 (79 residues), 80.9 bits, E=3.1e-27
• PF02700: PurS
  • amino acids 2 to 79 (78 residues), 105.9 bits, E=5e-35

Best Hits

Swiss-Prot: 50% identical to PURS_MYCLE: Phosphoribosylformylglycinamidine synthase subunit PurS (ML2219.1) from Mycobacterium leprae (strain TN)

KEGG orthology group: K01952, phosphoribosylformylglycinamidine synthase [EC: 6.3.5.3] (inferred from 98% identity to rpx:Rpdx1_1523)

Predicted SEED Role

"Phosphoribosylformylglycinamidine synthase, PurS subunit (EC 6.3.5.3)" in subsystem De Novo Purine Biosynthesis (EC 6.3.5.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (4/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.3

Use Curated BLAST to search for 6.3.5.3

Protein Sequence (81 amino acids)

>TX73_019775 phosphoribosylformylglycinamidine synthase subunit PurS (Rhodopseudomonas palustris CGA009)
MKARVTVTLKNGILDPQGKAIEGALKSLGVAGIASVRQGKVFDIELDGAADKAKAEAALK
DAADKLLANTVIENYRVEVLG