Protein Info for TX73_019735 in Rhodopseudomonas palustris CGA009
Annotation: GIY-YIG nuclease family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 40% identical to Y776_NATPD: UPF0213 protein NP_0776A (NP_0776A) from Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / NBRC 14720 / NCIMB 2260 / Gabara)
KEGG orthology group: None (inferred from 99% identity to rpt:Rpal_4335)Predicted SEED Role
"Excinuclease ABC, C subunit-like"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (95 amino acids)
>TX73_019735 GIY-YIG nuclease family protein (Rhodopseudomonas palustris CGA009) MAYWVYILASAPGGTLYVGVTNDLVRRTYEHREGLVEGFTRKYGVKRLVYFEAHDSIIAA IQREKNIKHWPREWKIDLIVRGNPDWDDLYEEIIR