Protein Info for TX73_019715 in Rhodopseudomonas palustris CGA009

Annotation: high-affinity branched-chain amino acid ABC transporter permease LivM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 132 to 162 (31 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details amino acids 360 to 385 (26 residues), see Phobius details amino acids 397 to 414 (18 residues), see Phobius details PF11862: DUF3382" amino acids 22 to 117 (96 residues), 72.1 bits, see alignment E=3.7e-24 PF02653: BPD_transp_2" amino acids 128 to 409 (282 residues), 161.6 bits, see alignment E=2.2e-51

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to rpt:Rpal_4331)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>TX73_019715 high-affinity branched-chain amino acid ABC transporter permease LivM (Rhodopseudomonas palustris CGA009)
MAKLAHAAAAPVAAATVGVGFIFKKALISALVALVLFSLMIGVRTEAGPEGGLIYWTRFG
DLAGMVGGVFVGSIVVELLRMWWGPVDTSKIMPAGARKTLGLAGRVVAPALLIFTFLVPV
IFYNQRYILDLGILVLTYVMLGWGLNIVVGLAGLLDLGYVAFYAVGAYSYALLATNFGLS
FWICLPLAGILAAFWGVILGFPVLRLRGDYLAIVTLAFGEIIRLVIINWQTLTGGPNGIS
GIPRPTLFGIPLAPGPNGLAAQLGIPFSPTHRLVFLFYLILILALITNWATIRLRRLPIG
RAWEALREDEVACRALGINTTTTKLTAFATGAMFGGFAGAFFATRQGFISPESFTFQESA
LVLAIVVLGGMGSQLGVALAAVTLIGGFELFRGLDQFRMLVFGMAMVLLMIWRPRGLIGH
RAPTVYLDHKQAISSDLVKEGHG