Protein Info for TX73_019710 in Rhodopseudomonas palustris CGA009

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 289 (282 residues), 165.4 bits, see alignment E=7.6e-53

Best Hits

Swiss-Prot: 53% identical to BRAD_PSEAE: High-affinity branched-chain amino acid transport system permease protein BraD (braD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to rpt:Rpal_4330)

MetaCyc: 50% identical to branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>TX73_019710 branched-chain amino acid ABC transporter permease (Rhodopseudomonas palustris CGA009)
MDYFAQQLINGLVLGSIYGLIAIGYTMVYGIVGMINFAHGDIFMIGGFIALISFLILVSF
GLTFVPLILLVVLLVSMAITALYGWTVERIAYRPLRHSFRLAPMLSAIGMSFVLMNYAQV
SQGARVKPVPPIITGGYTLHESADGFNVQLSNVQILVVVTTVVLLGIFTWLVAKTRLGRD
MRACEQDQTMAALLGVDVDRTISMTFVIGAALASVAGMMYLLYYGLIDFFMGFIAGIKAF
TAAVLGGIGSLPGAMLGGLLIGLIETFWSAYFSVEYKDVAAFSILIIVLIFMPTGLLGRP
EVEKV