Protein Info for TX73_019585 in Rhodopseudomonas palustris CGA009

Annotation: glycosyltransferase family 39 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 64 (18 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 126 to 179 (54 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details PF13231: PMT_2" amino acids 48 to 209 (162 residues), 130.9 bits, see alignment E=5.5e-42 PF02366: PMT" amino acids 61 to 216 (156 residues), 25.6 bits, see alignment E=8.7e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_4304)

Predicted SEED Role

"Bll5638 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>TX73_019585 glycosyltransferase family 39 protein (Rhodopseudomonas palustris CGA009)
MRRPAVATILVVVGLVALRLIAAAVTPLTFDEAYYWTWSKNLALSYFDHPPMVAVVIKLG
TLIAGDTEFGVRLVSILLALPMSWAVWRAAILLFDDERIAATATVLLNATMMVSAGTTIV
TPDAPLLVASSFVLLALAEVAATGRGVWWLAVGVAVGLALLSKYTALFFGPAILIWLLWV
PALRRWLLSPWPYLGGMVAFALFSPVVIWNAQHEWISFVKQFGRAKLGGFEPHFLAELIP
TQFVLATPFVFVLGVMGLIALGKRSTGPAASRVLVAATVWTIALYFAWQALHDRVEANWL
SPLYPAFALAAAVGAAYPHWTPGIARVVTVCRRWAVSTGAVLFALVVVQVNTGALTGYRR
DATVRSVGVGVPQMVAEIDQVRRRIGASCVLTDDYGTTGWLAFYLPPGTCVVQRGERFRW
IAAPAPTAQQLAGPLLLVGVDNAAARPDLQGAFGRIERVGAVTRSRGPLLVDAVALDMLS
DPKGQILDLRPPIY