Protein Info for TX73_019410 in Rhodopseudomonas palustris CGA009

Annotation: DUF4070 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 transmembrane" amino acids 488 to 501 (14 residues), see Phobius details PF02310: B12-binding" amino acids 34 to 137 (104 residues), 34.9 bits, see alignment E=1.8e-12 PF04055: Radical_SAM" amino acids 184 to 351 (168 residues), 62.9 bits, see alignment E=6.5e-21 PF13282: DUF4070" amino acids 371 to 509 (139 residues), 118.6 bits, see alignment E=3.4e-38

Best Hits

Swiss-Prot: 99% identical to HPNP_RHOPT: Hopanoid C-2 methylase (hpnP) from Rhodopseudomonas palustris (strain TIE-1)

KEGG orthology group: None (inferred from 100% identity to rpa:RPA3748)

MetaCyc: 99% identical to 2-methylbacteriohopanetetrol synthase [multifunctional] (Rhodopseudomonas palustris TIE-1)
2.1.1.-; 2.1.1.-; 2.1.1.-

Predicted SEED Role

"Hopanoid 2-methyltransferase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (527 amino acids)

>TX73_019410 DUF4070 domain-containing protein (Rhodopseudomonas palustris CGA009)
MKAESGQTSRRILCVFPRYTKSFGTFQHSYPLMDDVAAFMPPQGLLVIAAYLPDEWSVRF
VDENIRPATADDFAWADAVFVSGMHIQRQQMNDICRRAHDFDLPVALGGPSVSACPDYYP
NFDYLHVGELGDATDQLIAKLTHDVTRPKRQVVFTTEDRLDMTLFPIPAYELAECSKYLL
GSIQYSSGCPYQCEFCDIPGLYGRNPRLKTPEQIITELDRMIECGIRGSVYFVDDNFIGN
RKAALDLLPHLVEWQKRTGFQLQLACEATLNIAKRPEILELMREAYFCTIFVGIETPDPT
ALKAMHKDHNMMVPILEGVRTISSYGIEVVSGIILGLDTDTPETGEFLMQFIEQSQIPLL
TINLLQALPKTPLWDRLQREGRLVHDDSRESNVDFLLPHDQVVAMWKDCMARAYQPEALL
KRYEYQIAHAYATRLHPSTPQRASKANIKRAMIMLRNVIWQIGIRGDYKLAFWKFAFRRL
FRGDIENLLLVMVVAHHLIIYAREASRGHANASNYSIRLREAAVPAE