Protein Info for TX73_019115 in Rhodopseudomonas palustris CGA009

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 48 to 68 (21 residues), see Phobius details amino acids 194 to 218 (25 residues), see Phobius details amino acids 239 to 271 (33 residues), see Phobius details amino acids 307 to 334 (28 residues), see Phobius details amino acids 356 to 380 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 208 to 389 (182 residues), 95.9 bits, see alignment E=1.3e-31

Best Hits

KEGG orthology group: K13895, microcin C transport system permease protein (inferred from 100% identity to rpa:RPA3689)

Predicted SEED Role

"Oligopeptide/dipeptide uptake family ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>TX73_019115 ABC transporter permease (Rhodopseudomonas palustris CGA009)
MTLIAREPIEATTQAPLGEAVPPTRNRLSLSPLNKRRWQNFKANRRGYWSFWLFLVLFGV
SLFAEFIANDRPLLIKLDGHYYFPAVVTYSETTFGGDFETAADYRDPFLQKLIADKGGTV
IWAPIRYSYGTHNLDLPTPAPSKPTWMLTEQECAAVVAKKGVKSCRDLEYNWLGTDDQGR
DVVARLIYGFRISILFGLSLTIISSVIGVAAGGIQGYFGGWVDLGFQRFIEVWTAIPSLY
LLLILSSVLVPGFFVLLGILLLFSWVSLVGLVRAEFLRGRNFEYITAARALGVSNAKIMV
RHLLPNAMVATMTFLPFIVSSSVMTLTALDFLGFGLPPGSPSLGELLAQGKANVQAPWLG
FTGFFAVAIMLSLLIFIGEAVRDAFDPRKTFR