Protein Info for TX73_018990 in Rhodopseudomonas palustris CGA009

Annotation: urease accessory protein UreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF01774: UreD" amino acids 59 to 257 (199 residues), 195.4 bits, see alignment E=5.9e-62

Best Hits

Swiss-Prot: 100% identical to URED_RHOPA: Urease accessory protein UreD (ureD) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K03190, urease accessory protein (inferred from 100% identity to rpa:RPA3664)

Predicted SEED Role

"Urease accessory protein UreD" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>TX73_018990 urease accessory protein UreD (Rhodopseudomonas palustris CGA009)
MATDTSLTTSQTFAANRAVGEVAVEVRADGGVTRRGPVHEAGSLRVRFPSPEQQGLSAVL
VNTAGGVAGGDRFSISLDVQAHARLTLTTAAAEKVYRTHGPAAQLDIKLKVASGGHLAWL
PQETILFDQARAERRIDIELADDASLLLSEMVIFGRSAMGETMQHGRFVDRWRMRRGGKL
VFAETVRLDGDIASLFGRPAVLNGGVAIGTALIVPGDAALVERLREAADTFGAEVGISAW
NGFAMARFCAQNAARLRADMMTILGRAAGRALPRLWLS