Protein Info for TX73_018975 in Rhodopseudomonas palustris CGA009

Annotation: HD domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF13328: HD_4" amino acids 10 to 135 (126 residues), 78.8 bits, see alignment E=3.9e-26

Best Hits

Swiss-Prot: 47% identical to MESH1_XENTR: Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (hddc3) from Xenopus tropicalis

KEGG orthology group: None (inferred from 100% identity to rpa:RPA3661)

Predicted SEED Role

"Metal dependent phosphohydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>TX73_018975 HD domain-containing protein (Rhodopseudomonas palustris CGA009)
MTDLVLVSRAADFAARRHAGTRRKGADKEPYVNHLAEVALLLTVATDGADAPLVAAGWLH
DTIEDTGVTRDELAEQFSADVAELVVACTDDKTLPKVERKRLQIEHAPHLTPRAKLIKLA
DKISNLRSLIVSPPDDWERDRLLDYLDWAEKVAAGCRGVNDHLENLFDETAARGRAVL