Protein Info for TX73_018935 in Rhodopseudomonas palustris CGA009

Annotation: molybdenum cofactor guanylyltransferase MobA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR02665: molybdenum cofactor guanylyltransferase" amino acids 7 to 196 (190 residues), 220.3 bits, see alignment E=1.1e-69 PF12804: NTP_transf_3" amino acids 8 to 166 (159 residues), 127.1 bits, see alignment E=3.8e-41

Best Hits

Swiss-Prot: 76% identical to MOBA_RHOPS: Molybdenum cofactor guanylyltransferase (mobA) from Rhodopseudomonas palustris (strain BisB5)

KEGG orthology group: K03752, molybdopterin-guanine dinucleotide biosynthesis protein A (inferred from 100% identity to rpa:RPA3654)

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>TX73_018935 molybdenum cofactor guanylyltransferase MobA (Rhodopseudomonas palustris CGA009)
MADALPTAVILAGGLARRMGGGDKPLRAVAGRPLLARVIERLQPQCRALALNANGDPARF
APFGLPVIADSVQGFPGPLAGVLAALDWAAAQQSDATCVLTAPGDCPFLPHDLVARLNEA
RLAEAAEIAVAASGGHLHPVIALWPVALRDALRTALFEDDIRKVERFTARYPRAVVEWPV
TPFDPFFNANTPEDVAEAERIAAGDQ