Protein Info for TX73_018845 in Rhodopseudomonas palustris CGA009

Annotation: glucose-6-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 14 to 502 (489 residues), 586.7 bits, E=1.8e-180
• PF00479: G6PD_N
  • amino acids 17 to 200 (184 residues), 205.4 bits, E=1.2e-64
• PF02781: G6PD_C
  • amino acids 202 to 501 (300 residues), 389.3 bits, E=9.9e-121

Best Hits

Swiss-Prot: 44% identical to G6PD_CHLMU: Glucose-6-phosphate 1-dehydrogenase (zwf) from Chlamydia muridarum (strain MoPn / Nigg)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 100% identity to rpt:Rpal_4157)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• pentose phosphate pathway (8/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
• Entner-Doudoroff pathway I (6/9 steps found)
• cytosolic NADPH production (yeast) (3/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (5/8 steps found)
• formaldehyde oxidation I (3/6 steps found)
• heterolactic fermentation (11/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Protein Sequence (504 amino acids)

>TX73_018845 glucose-6-phosphate dehydrogenase (Rhodopseudomonas palustris CGA009)
MTTQANSNQVPEGCAFVIFGATGDLTHRLVIPALYNLAEANLLPEKFCVVGVTRKEMSSD
DLRDSLMQGLRKYATRPVDDKVADQLLYCVTAVSADPSEPASFERLRERLEKLEANRNTG
GNRLFYLATPPDAFAPIATELGRAGLLKETSGAWRRLVVEKPFGTDLASAKALNDHLLSI
ISEHELYRIDHYLGKETVQNILVLRFSNGMFEPIWNREHIDHIQITVEEKLGVGHRGSFY
DKTGALRDMVPNHLFQLLSLVAMEPPAHFNAHAVRSAKADVLAAIQIQTEEEALRNSVRG
QYTSGKIGDTDIPDYRSAKDVAADSTTETFAALTLSIDNWRWAGVPFYLRTGKALSGKRT
EVAIKFKEAPFSMFRCTPVQELSQNFLVIGIEPVEGISLQFNTKVPGPMIAIDGVEMTFR
YKDYFKVAPSNGYETLLHDCMIGDNILFQRADGVEAGWRAVQPFLDAWKKAGAHGLQIYR
AGSDGPEDADELLGRDGRNWRKPT