Protein Info for TX73_018380 in Rhodopseudomonas palustris CGA009

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 280 to 299 (20 residues), see Phobius details PF14827: dCache_3" amino acids 40 to 269 (230 residues), 78.1 bits, see alignment E=1.3e-25 PF00672: HAMP" amino acids 298 to 349 (52 residues), 37.7 bits, see alignment 3.2e-13 PF00015: MCPsignal" amino acids 455 to 615 (161 residues), 113.6 bits, see alignment E=1.4e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA3546)

Predicted SEED Role

"Methyl-accepting chemotaxis receptor/sensory transducer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (651 amino acids)

>TX73_018380 methyl-accepting chemotaxis protein (Rhodopseudomonas palustris CGA009)
MLKSISARMIVAITLVAIGSCVVLAGFSVWRQKATIDVALERELRADFANITAATEAETR
TTLALSDVLAALPPLRELTKASDRDGLMKLLKEGRDLTTLRGLSLYTIQVPPATTLMRIH
NPKTFGDDVSGRRAMVVQAMTTGKAVGGIEPGLDNLTVFGTTPMVEDGKVIGTVDIGAPF
GKAFVERMKARFGVDVAILQINGDKTNVIASSLPNPVTDLATLRRAFGGELMIEKGEADG
KAIATTFGPLKRFSGEPVAVLMIARDASAYAALERQSMQWLAFAAIVAVLAAAAIAIWLG
RSMAKPIQALGNAMRDISSGRHDVEVPGRGRSDEIGLMAQAVEVFKEGLIETGRLRAAQD
EQRITHETERRKAMHELAARFETGVGSVVELVGSAATELRGTADSMVGTARESERRLVAA
TAASQQATSNAQAVAAAVEELDASITEIGNRVDQSARVAGEAATQAGRTNEEVRSLAEAA
QKIGEVVTLISDIASQTNLLALNATIEAARAGDAGRGFAVVAAEVKALAEQTSKATEEIT
TQINSIQQATQSSVQAIEGITGTVAQINEIATAIASAVREQSAATREIAHNVAESARSTT
EVSSNISGVNEAARETGVAAGQVVESASELSRSGEALKTQVDTFLREVRAA