Protein Info for TX73_018305 in Rhodopseudomonas palustris CGA009

Annotation: UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase" amino acids 12 to 461 (450 residues), 350.4 bits, see alignment E=8.9e-109 PF08245: Mur_ligase_M" amino acids 119 to 300 (182 residues), 110.4 bits, see alignment E=1.2e-35

Best Hits

Swiss-Prot: 100% identical to MURD_RHOPA: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 100% identity to rpa:RPA3532)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>TX73_018305 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (Rhodopseudomonas palustris CGA009)
MIPVTSFAGQSVAVFGLGGSGLASCHALKAGGAEVIACDDNLDRMVEAAQAGFITADLRN
LPWTNFAALVLTPGVPLTHPAPHWTVLKAQEAGVEVIGDVELFCRERKAHAPRAPFVAIT
GTNGKSTTTALIAHLLREAGWDTQLGGNIGTAILSLEPPKDGRVHVIEMSSYQIDLTPSL
DPTVGILLNVTEDHIDRHGTIEHYAAVKERLVAGVQDGGTSIIGVDDEFGRAAADRIERA
GKRVVRMSVQGPVTFGITADLDSIRRVDGGTSTEVAKLGGIGSLRGLHNAQNAAAAAAAV
LALGVSPEVLQQGLRSFPGLAHRMEQVGRQVGEQGTTLFVNDSKATNADAAAKALASFGD
IFWIAGGKPKTGGIESLAEYFPRIRKAYLIGQAAQEFAATLEGRVPYEISETLEAAVPAA
ARDAAASGLAEPVVLLSPACASFDQFRNFELRGTRFRELVTALDGVAAV