Protein Info for TX73_018245 in Rhodopseudomonas palustris CGA009

Annotation: outer membrane protein assembly factor BamD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 29 to 270 (242 residues), 284.3 bits, see alignment E=3.8e-89 PF13512: TPR_18" amino acids 58 to 189 (132 residues), 52.2 bits, see alignment E=2.7e-17 PF13525: YfiO" amino acids 60 to 256 (197 residues), 174.5 bits, see alignment E=8.7e-55 PF13174: TPR_6" amino acids 103 to 134 (32 residues), 16.5 bits, see alignment 3.6e-06 amino acids 139 to 179 (41 residues), 23.9 bits, see alignment 1.7e-08 PF13432: TPR_16" amino acids 105 to 179 (75 residues), 32.7 bits, see alignment E=3e-11

Best Hits

KEGG orthology group: K05807, putative lipoprotein (inferred from 100% identity to rpt:Rpal_4038)

Predicted SEED Role

"competence lipoprotein ComL, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>TX73_018245 outer membrane protein assembly factor BamD (Rhodopseudomonas palustris CGA009)
MSAQRIALGLRNGETSRRGDRLRRGLPMVFSLLALSLPLGGCGTGALWDKFLAKDDKMVD
EPADKLYNEGLYLMNQDKDTKGAAKKFEEVDRQHPYSDWARKSLLMSAYAYYQAGDYDSC
IGSATRYVTLHPGSPDAAYAQYLIAASNYDQIPDISRDQGRTEKAIAALEEVIRKYPTSE
YANSAKQKLEGARDQLAGKEMDIGRYYMSKRDYAAAINRFKTVVTRYQTTRHVEEALARL
TEAYMAIGIVGEAQTAAAVLGHNFPDSRWYKDAYNLVKSGGLEPAENKGSWISKSFKKLG
LG