Protein Info for TX73_018065 in Rhodopseudomonas palustris CGA009

Annotation: Do family serine endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details TIGR02037: peptidase Do" amino acids 44 to 490 (447 residues), 488.6 bits, see alignment E=8.5e-151 PF00089: Trypsin" amino acids 111 to 274 (164 residues), 75.3 bits, see alignment E=1.6e-24 PF13365: Trypsin_2" amino acids 112 to 248 (137 residues), 124.5 bits, see alignment E=1.5e-39 PF00595: PDZ" amino acids 285 to 364 (80 residues), 27.1 bits, see alignment E=1.1e-09 amino acids 403 to 486 (84 residues), 23.6 bits, see alignment E=1.3e-08 PF13180: PDZ_2" amino acids 288 to 378 (91 residues), 58.8 bits, see alignment E=1.4e-19 PF17820: PDZ_6" amino acids 314 to 367 (54 residues), 38.2 bits, see alignment 2.5e-13

Best Hits

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 100% identity to rpt:Rpal_4002)

Predicted SEED Role

"HtrA protease/chaperone protein"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>TX73_018065 Do family serine endopeptidase (Rhodopseudomonas palustris CGA009)
MPAAIAFSSRIRPLRIRPLLAALCLGAAVIAGPAPASARGPEGIADVAEKVIDAVVNIST
TQTVDAKGSGESKGGAAPQLPPGSPFEEFFEDFFKNRRGEKGGGPRKTNSLGSGFIIDPA
GVVVTNNHVIADSDEINVILNDGTKIKAELVGVDKKTDLAVLKFKPPAGKTLTAVKFGDS
DKLRLGEWVIAIGNPFSLGGTVTAGIVSARNRDINSGPYDSYIQTDAAINRGNSGGPLFN
LAGEVIGVNTLIISPSGGSIGIGFAVPSKTVVPVVDQLRQFGELRRGWLGVRIQQVTDEI
AESLSIKPARGALVAGVDDKGPAKPAGIEPGDVVVKFDGKDIKEPKDLSRIVADTAVGKT
VDVVVIRKGKEETKQVTLGRLDDDAKPQPASAKSQPEADKPVTQKVLGLDLAALSKDLRG
RYKIKDSVKGVLVTGVDDGSDAAEKRLSAGDVIVEVAQESVGSAADIKKRVDQLKKDGKK
SVLLLVANASGELRFVALSLQ