Protein Info for TX73_018000 in Rhodopseudomonas palustris CGA009

Annotation: tonB-system energizer ExbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 88 to 110 (23 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details TIGR02797: tonB-system energizer ExbB" amino acids 78 to 287 (210 residues), 334.5 bits, see alignment E=1.4e-104 PF01618: MotA_ExbB" amino acids 150 to 269 (120 residues), 117.9 bits, see alignment E=1.3e-38

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to rpt:Rpal_3967)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>TX73_018000 tonB-system energizer ExbB (Rhodopseudomonas palustris CGA009)
MNKLSFRSIGVALIALSLSAPLAPSVAQQPAPPPAATAPSQPAAPAPAVTAPAPASSQAL
PEAGHQPGTVTPGLSELSPWTMFLNADIIVKIVMIGLAISSVITWTIFIAKKVELGRARF
RLRRSLKEIGESRSLAEAQMALGDKHSVLSMLLAAALREAKLSAGLSSDEGIKERAASSF
SEYVRAEGRHMRRGMGFLATIGATAPFIGLFGTVWGIMNSFIGISKSQTTNLAVVAPGIA
EALLATAIGLVAAIPAVIIYNHFSREIKLYLELVARASGAAGRLLSRDLDRSHGSAHRAR
AAE