Protein Info for TX73_017310 in Rhodopseudomonas palustris CGA009

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 210 to 227 (18 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 331 to 351 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 15 to 344 (330 residues), 103 bits, see alignment E=8.9e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA3349)

Predicted SEED Role

"Exopolysaccharide production protein ExoZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>TX73_017310 acyltransferase (Rhodopseudomonas palustris CGA009)
MTGSVDIDVNRRRIDAIQLLRAFAATAVVFTHATTRIGYLFPEGKASSHLFDGISGQVRV
GDAGVDLFFVISGFVMLYVHRNDFGQPGAVTGFFKKRITRIVPLYWLLTTVAVSVTVLSP
GLFTTHYAAADPAWVAGSYLFLPIPAPGRELSPVIGVGWTLNYEMFFYLVFGVLLTLPRP
AALPFLLASFTVLVGLGVALAPAAPWAKFATSWLLLEFLLGIGIAYWKLSGGQLSVKAAR
VLAALSLAALLATVYWTPDEQGAGRFAFWGIPAAGIVVAATNLDVGTGRPRRLAAVLGDA
SYSIYLFQVFALPMWGLVMSHLGFGMLPFDLNVVILTILVVASGVAGWALVERPLSRAIK
QLLAGSPQRDHPVGELRS