Protein Info for TX73_017270 in Rhodopseudomonas palustris CGA009

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 55 (18 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 220 to 237 (18 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 297 to 319 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 2 to 312 (311 residues), 35 bits, see alignment E=4.4e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_3763)

Predicted SEED Role

"FIG01201438: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>TX73_017270 acyltransferase (Rhodopseudomonas palustris CGA009)
MKVSLAVMVIATHSVLTSYGQAADAAMWDTPARPFLRSVLPMFFGVSGFLVAASLDRCKT
LIKFFGLRAIRIFPALAVEVLLSAFLIGPMLTTLAWSDYFTDKLFFLYLLNAIGEIHYLL
PGVFHDNPKPDIVNAQLWTVPFELYTYGAVGLLAIAGVQRYRILGPISVVALIVFHFVAR
LWWHGWQYLPFSGNVPGFALMISGIVGLSLYYYRYEIPWRWSLFWCATAIALLGLYSRYG
GEYFGALVVPYVAIFLGLTTPRRLAIVRDRDYSYGMYLYGFVIQQTFVATIPSGRVWWIN
ILVCVPLAAILAAMSWHFVERPAQQLKSLVGSLETQYLRIMRRTTVVPRSAPVRADA