Protein Info for TX73_017030 in Rhodopseudomonas palustris CGA009

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00005: ABC_tran" amino acids 25 to 182 (158 residues), 103 bits, see alignment E=2.3e-33 PF12399: BCA_ABC_TP_C" amino acids 230 to 254 (25 residues), 44 bits, see alignment (E = 1.3e-15)

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA3294)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>TX73_017030 ABC transporter ATP-binding protein (Rhodopseudomonas palustris CGA009)
MNVNSDIVLHIDHVHKTFAGLHALADVHLDIREGETHAIIGPNGAGKSTLLNVCVGVLPP
TQGKVMFHGTELTGLKPYEINQLGVARVFQTPEIFGDLTVLENVMMAMLSHQDGAFRLKL
VSRFDEQGDIGQRAVQALRERGLGGHLYHLAGALSRGDKRRLELVMGLVQKPKLLLLDEP
TAGMARADTNATIEILRQIKQSGMTIVIIEHDMHVVFSLADRITVLAGGRVIAQGVPDEI
KGNPKVIEAYLGEEQV