Protein Info for TX73_017005 in Rhodopseudomonas palustris CGA009

Annotation: acyl-CoA dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 PF02771: Acyl-CoA_dh_N" amino acids 6 to 134 (129 residues), 53.6 bits, see alignment E=5.8e-18 PF02770: Acyl-CoA_dh_M" amino acids 138 to 236 (99 residues), 71.3 bits, see alignment E=1.3e-23 PF00441: Acyl-CoA_dh_1" amino acids 251 to 399 (149 residues), 127.6 bits, see alignment E=9.3e-41 PF08028: Acyl-CoA_dh_2" amino acids 268 to 380 (113 residues), 52.1 bits, see alignment E=1.6e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpx:Rpdx1_2148)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7

Use Curated BLAST to search for 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>TX73_017005 acyl-CoA dehydrogenase family protein (Rhodopseudomonas palustris CGA009)
MDFTMSDRQREWLDRVTKFMNDHVRPAVPIYKQQDAEGERWKVIPVLEELKAKAKAEGLW
NLFLPPSSHDDDEFHGAGLSNLEYALLSEQMGHISWASEVFNCSAPDTGNMEVLFRYGTK
EQKQKWLRPLMAGEIRSAFLMTEPAVASSDATNIETRIEKDGDHYVINGRKWWSSGVGDP
RCKIAIVMGKTDPNAARHQQQSQILVPLDTPGITIEKMLPVFGFDDAPHGHGMVKLENVR
VPASNLLLGEGRGFEIAQGRLGPGRIHHCMRTIGKAEEALEKMVKRLQSRVAFGKRIIEF
SVWEQRIAEARIDIEMNRLLCLKAADMMDKVGNKTAQLEIAMIKVAAPRMAQRIIDEAIQ
AFGGAGVSDDAGLAKDYANIRTLRLADGPDEVHNRAIARLEMKKYANAAH