Protein Info for TX73_016880 in Rhodopseudomonas palustris CGA009

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 712 transmembrane" amino acids 142 to 163 (22 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 244 to 267 (24 residues), see Phobius details amino acids 269 to 296 (28 residues), see Phobius details amino acids 371 to 390 (20 residues), see Phobius details amino acids 411 to 431 (21 residues), see Phobius details PF00664: ABC_membrane" amino acids 144 to 405 (262 residues), 118.8 bits, see alignment E=5.5e-38 PF00005: ABC_tran" amino acids 478 to 626 (149 residues), 131.9 bits, see alignment E=4e-42 PF09818: ABC_ATPase" amino acids 564 to 672 (109 residues), 26.1 bits, see alignment E=6.4e-10

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 99% identity to rpa:RPA3265)

Predicted SEED Role

"Phospholipid-lipopolysaccharide ABC transporter" in subsystem N-linked Glycosylation in Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (712 amino acids)

>TX73_016880 ATP-binding cassette domain-containing protein (Rhodopseudomonas palustris CGA009)
MARKPNPPVTPDSRPDDKSAATPSADAAAGSPAPGSEGAAPPASPLDEKFALPVGAAAPV
VPTTKPPVKQLIADKVPAAPVPGAKAAAAADDGDDDDEDDDEEDDDDDEDEELVVFTARE
AAGALATIAGFIRPVVANYKKMLAFVVFGVVVETLFNVIMPLSLKFLIDDALGEEDFHEL
YKILSILGVAGVITSIIAVWYERWDARLSAAVISDVRTRLFEHTQRLPAGYFARTKRGEI
LSRFSIDMAAFSRVVEILANTALLPFLELIAGIILMLFLNWQLAVVALLIFPITLIGPRI
LTPKAVQANYEQKVQEAGLLGLLQENVGAQAVVKAFSLQRKMFGFFSLRNQATRQKMGQA
TFLTSMVERSVTVSVLMLHLLVLALGAYLATTGQITVGTFVTFESAFWEVSYNIAHLMQF
IPVSIQAAAAVRHMQELLDEKTPISDKPGAAEMPRIVDNIAFERVSFAYEGAEQPVIDNL
SLKLKAGKTIAIVGPSGSGKSTLLNMVLRLYDPTEGRISIDGVDIRNVTLDSLRRSMAVV
FQENMLFNMSIRDNIRLGKEGATDAEVEQAAKKAEIHRYIMSLPQKYDTVVGERGDTLSG
GQRQRIAIARAIVRDPSVLLLDEATSALDQTTEAAINKTLMKLARGRTMIFSTHRLTSVV
DMDEIVVVSGGQAIERGSHKELLAKNGAYRKLWDDQKRHGAGDDDDDDDDDE