Protein Info for TX73_016725 in Rhodopseudomonas palustris CGA009

Annotation: 50S ribosomal protein L18

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00861: Ribosomal_L18p
  • amino acids 5 to 120 (116 residues), 156.9 bits, E=1.2e-50
• TIGR00060: ribosomal protein uL18
  • amino acids 8 to 120 (113 residues), 152.6 bits, E=2.6e-49

Best Hits

Swiss-Prot: 100% identical to RL18_RHOPT: 50S ribosomal protein L18 (rplR) from Rhodopseudomonas palustris (strain TIE-1)

KEGG orthology group: K02881, large subunit ribosomal protein L18 (inferred from 100% identity to rpt:Rpal_3651)

MetaCyc: 53% identical to 50S ribosomal subunit protein L18 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L18p (L5e)" in subsystem Ribosome LSU bacterial

Protein Sequence (120 amino acids)

>TX73_016725 50S ribosomal protein L18 (Rhodopseudomonas palustris CGA009)
MSKMKITNARRTNRVRTALRRTANGRPRLSVFRSSKHIYAQVIDDAKGETLASASSLEKT
MRDAGNTGANIDAAKAVGKLVAERAVEKGVKEVVFDRGGYLYHGRVKALADAARESGLSF