Protein Info for TX73_016720 in Rhodopseudomonas palustris CGA009

Annotation: 30S ribosomal protein S5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01021: ribosomal protein uS5
  • amino acids 21 to 175 (155 residues), 216.9 bits, E=6.3e-69
• PF00333: Ribosomal_S5
  • amino acids 24 to 86 (63 residues), 98.9 bits, E=1.4e-32
• PF03719: Ribosomal_S5_C
  • amino acids 100 to 170 (71 residues), 102.2 bits, E=8.4e-34

Best Hits

Swiss-Prot: 100% identical to RS5_RHOPA: 30S ribosomal protein S5 (rpsE) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 100% identity to rpt:Rpal_3650)

MetaCyc: 55% identical to 30S ribosomal subunit protein S5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Protein Sequence (191 amino acids)

>TX73_016720 30S ribosomal protein S5 (Rhodopseudomonas palustris CGA009)
MAAERERGGRERSREREERDSEFVDKLVHINRVAKVVKGGKRFGFAALVVVGDQKGRVGF
GHGKAREVPEAIRKATESAKRNLTRVALREGRTLHHDIAGRHGAGRVYLRAAPAGTGIIA
GGPMRAVFETLGIADVVAKSVGSSNPYNMVRATFDALKHLDSPRSVAARRNIKVSTLQAR
RVGGDAEVVAE