Protein Info for TX73_016700 in Rhodopseudomonas palustris CGA009

Annotation: adenylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01351: adenylate kinase
  • amino acids 2 to 190 (189 residues), 203.3 bits, E=1.7e-64
• PF00406: ADK
  • amino acids 5 to 169 (165 residues), 187.8 bits, E=2e-59
• PF13207: AAA_17
  • amino acids 6 to 146 (141 residues), 93.1 bits, E=2.9e-30

Best Hits

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 100% identity to rpa:RPA3229)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• superpathway of purine nucleotide salvage (11/14 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.3

Protein Sequence (371 amino acids)

>TX73_016700 adenylate kinase (Rhodopseudomonas palustris CGA009)
MRLILLGPPGAGKGTQAGRLVEQHGIVQLSTGDMLRAAVAAGTPIGLKAKDIMAAGGLVP
DEVVIGIISDRIDQDDAAQGFILDGFPRTVPQAEALDRLLKDKGFDLDAVVELKVNEGAL
LDRVETRVAEMRARGEEPRADDNAEALAKRLSAYRAQTEPLVDYYSEKRKLLTVDGMMTI
DEVTREIGRVLDAVRAADAKKGAKAKGTKASRAKRTVKTAKKAATKGKAAKSAAKAPKKA
AAKPAAKSGAKSGSAKKSSAKQTVGKKSSGKTAVSKKVAGKPAASKAGKAAVGKTAKAGL
KKAAKAVAKAGKKAAKAAVKAAKGAAKPTAGKKAAGKKATKKAAATSKAKAVAKAPARGS
KKAKKATKKRA