Protein Info for TX73_016550 in Rhodopseudomonas palustris CGA009

Annotation: bifunctional protein-serine/threonine kinase/phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 transmembrane" amino acids 552 to 572 (21 residues), see Phobius details PF13672: PP2C_2" amino acids 40 to 199 (160 residues), 54.6 bits, see alignment E=2.8e-18 PF00481: PP2C" amino acids 181 to 231 (51 residues), 20.4 bits, see alignment 9.3e-08 PF00069: Pkinase" amino acids 283 to 522 (240 residues), 123.8 bits, see alignment E=2.2e-39 PF07714: PK_Tyr_Ser-Thr" amino acids 297 to 528 (232 residues), 79.3 bits, see alignment E=7.6e-26

Best Hits

KEGG orthology group: K00924, [EC: 2.7.1.-] (inferred from 100% identity to rpa:RPA3200)

Predicted SEED Role

"serine/threonine protein kinase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (577 amino acids)

>TX73_016550 bifunctional protein-serine/threonine kinase/phosphatase (Rhodopseudomonas palustris CGA009)
MAQQLTVSIGQASSPGRKPVNQDFYGALIPAEPLLITKGIALALADGISSSDISQVASES
AVKSFLTDYYCTSEAWSVKSSAQRVIAATNSWLHAETRRSDYRYDRDKGYVCTLSALVIK
GAAAHLFHIGDSRIYRLAGASLEQLTEDHRVRLSAEQSYLGRALGVNPQVEIDYLSVPIG
SGDLFVLATDGVYEHVAHRFVVQTLRDHGDDLDAAARAIVGEAFNNGSDDNLTVQVVRIE
SVPGADSIDLFERVAELPLPPLLEPRAEFDGYRIIRELHGSSRSHIYLASDLATGELVVL
KIPSADLRDDPEYRKRFMLEEWAARRIDSPHVLKPCVVQRPRSYLYVTFEYIEGQTLAQW
MIDHPRAELETVRGLIEQIAKGLYAFHRKEMVHQDLRPANVLIDRSGTVKIIDFGSVRVA
GVAELGPAGGDELLGTVQYMAPEYFAGQGGSALSDQFSLGVIAYQMLTGRLPYGAELARA
NQALKSRKLRYSAAADHNAKVPVWVDRALQRAVSLDPAKRYPALSEFVHDLRHPRADYLD
ARPQPLAARNPLLFLQLLSALLALIVVGLLARLHGSI