Protein Info for TX73_016390 in Rhodopseudomonas palustris CGA009

Annotation: lipoyl(octanoyl) transferase LipB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00214: lipoyl(octanoyl) transferase
  • amino acids 57 to 214 (158 residues), 153.7 bits, E=2.1e-49

Best Hits

Swiss-Prot: 100% identical to LIPB_RHOPA: Octanoyltransferase (lipB) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K03801, lipoyl(octanoyl) transferase [EC: 2.3.1.181] (inferred from 99% identity to rpt:Rpal_3579)

Predicted SEED Role

"Octanoate-[acyl-carrier-protein]-protein-N-octanoyltransferase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.181

Protein Sequence (245 amino acids)

>TX73_016390 lipoyl(octanoyl) transferase LipB (Rhodopseudomonas palustris CGA009)
MINISTSPRQTLDWTALKPADGSPAVEWRISDSPVPYPEAVATMEARAAAIAAGEATELV
WLLEHPPLYTAGTSGHASDLLEERFPLFTTGRGGQLTYHGPGQRVAYVMLDLKRRRPDVR
AYVAALEQWIIATLDAFNIRGERREDRVGVWVRRPDKGVGYEDKIAAIGVRLKRWVSLHG
IAINVEPDLSHFKAIVPCGISDPRYGVTSLVDLGLPVVMTDVDIALRAAFENIFGETRAA
APAGI