Protein Info for TX73_016345 in Rhodopseudomonas palustris CGA009

Annotation: aldo/keto reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 174 to 191 (18 residues), see Phobius details PF00248: Aldo_ket_red" amino acids 19 to 257 (239 residues), 201.4 bits, see alignment E=8.8e-64

Best Hits

Swiss-Prot: 40% identical to DKGA_CORSC: 2,5-diketo-D-gluconic acid reductase A (dkgA) from Corynebacterium sp. (strain ATCC 31090)

KEGG orthology group: K00011, aldehyde reductase [EC: 1.1.1.21] (inferred from 100% identity to rpa:RPA3161)

MetaCyc: 40% identical to 2,5-diketo-D-gluconate reductase A monomer (Corynebacterium sp. SHS 0007)
RXN0-7020 [EC: 1.1.1.346]

Predicted SEED Role

"oxidoreductase, aldo/keto reductase family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.21

Use Curated BLAST to search for 1.1.1.21 or 1.1.1.346

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>TX73_016345 aldo/keto reductase (Rhodopseudomonas palustris CGA009)
MQTADAHFVEAHGAKIPALGLGTWELSGHSCSRIVEQALRLGYRHIDTAQIYDNEREVGE
GIRNSHIRRDQLFVTTKVWTTHFAPNDLVRSAKESLVKLRLSEVDLLLLHWPNAHVPLAE
TLGALAQARALGLTRHIGVSNFTVALLAEAVAVCPAPLVCNQVEYHPFLDQQKVLAACAL
YGMALVAYSPIARGNAKKSEVLTRIGNVHGKTAAQVCLRWLIQQNVAAIPRSSRLERLAQ
NIDVFDFELSDAEMQEIFTLGSPKGRLTTMPTAPVWD