Protein Info for TX73_016330 in Rhodopseudomonas palustris CGA009

Annotation: glutathione S-transferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13417: GST_N_3
  • amino acids 11 to 82 (72 residues), 51.2 bits, E=2.6e-17
• PF13409: GST_N_2
  • amino acids 12 to 78 (67 residues), 58.6 bits, E=1.5e-19
• PF02798: GST_N
  • amino acids 13 to 78 (66 residues), 37.4 bits, E=5.2e-13
• PF13410: GST_C_2
  • amino acids 103 to 204 (102 residues), 29.2 bits, E=1.6e-10

Best Hits

KEGG orthology group: K04097, glutathione S-transferase [EC: 2.5.1.18] (inferred from 100% identity to rpa:RPA3159)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Protein Sequence (218 amino acids)

>TX73_016330 glutathione S-transferase family protein (Rhodopseudomonas palustris CGA009)
MARTLVIGNKNYSSWSMRPWIALKATGVAFDEVVIPLYTGDADKRRILAFTPAGKVPVLV
DGDVTIWDSLAIIEYAAERFPKAQLWPDDVAARAHARSVAAEMHSGFAALRNECGMNIHR
PVGAKQLSDAARADIARVQEIWIDCRHRYGRFGPYLFGRFSGVDAMFAPVVHRFRTYAVE
LDPIAQGYVEVMMALPAFQEWTQAALAETWVIDKFETD