Protein Info for TX73_016275 in Rhodopseudomonas palustris CGA009

Annotation: ATP-dependent Clp protease adapter ClpS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF02617: ClpS" amino acids 26 to 104 (79 residues), 116.3 bits, see alignment E=2.1e-38

Best Hits

Swiss-Prot: 100% identical to CLPS2_RHOPA: ATP-dependent Clp protease adapter protein ClpS 2 (clpS2) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K06891, ATP-dependent Clp protease adaptor protein ClpS (inferred from 100% identity to rpt:Rpal_3557)

Predicted SEED Role

"ATP-dependent Clp protease adaptor protein ClpS" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>TX73_016275 ATP-dependent Clp protease adapter ClpS (Rhodopseudomonas palustris CGA009)
MAGDGGRSGPSTPSTSVITKTKPRTKRPNLYRVLILNDDYTPMEFVVHVLEKFFQMDVEA
ATKVMLHVHHHGIGECGVFTYEIAETKVTQVMDFARKHQHPLQCVMEKK