Protein Info for TX73_016160 in Rhodopseudomonas palustris CGA009

Annotation: ribonuclease R

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 781 TIGR02063: ribonuclease R" amino acids 12 to 723 (712 residues), 698.7 bits, see alignment E=8.8e-214 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 123 to 712 (590 residues), 471.3 bits, see alignment E=4.8e-145 PF17876: CSD2" amino acids 174 to 244 (71 residues), 35.4 bits, see alignment E=1.4e-12 PF00773: RNB" amino acids 262 to 591 (330 residues), 337.6 bits, see alignment E=1.3e-104 PF00575: S1" amino acids 640 to 693 (54 residues), 28.8 bits, see alignment 2e-10

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 100% identity to rpt:Rpal_3536)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (781 amino acids)

>TX73_016160 ribonuclease R (Rhodopseudomonas palustris CGA009)
MSKPRDAKFPDKATLLAFIRAHPGKVGTREIAREYGLKNADRAELKRMLRELADGGSIRK
SGRRKVSEPATLPPTLLADIVSRDADGELIATPSEWDEQDGDAPKILIHTPRRIKPGTAA
GVGDRALLHVEAADSREAGPAYVGRVIRVLERGKARILGIFRALPQGGGRMVPVDKKQAG
RELNIAAHDAGGAQDGDLVSVDLIRTRSFGLASGRVKERLGSLASEKAISLIAIHTHDIP
QDFSSAAISESEAAQPATLSGREDWRELPLVTIDPPDAKDHDDAVHAAPDPDPNNKGGVI
LHVAIADVAYYVRPGSALDRDALRRGNSVYFPDRVVPMLPERISNDLCSLKPGQPRGALA
VRMVIDAQGRKRSHSFHRVLMRSAAKLSYAQAQAAIDGKPDDVTGPLLETILKPLYDAYA
VVKRGRDERDPLDLDLPERKIILKPDGTVDRVIVPERLDAHRLIEEFMILANVAAAEMLE
KKALPLIYRVHDEPSVEKVHNLVDFLKTLDLSFAKGGALRPAQFNRILAMVKGEDSEPLV
NEVVLRSQAQAEYSSENYGHFGLNLRRYAHFTSPIRRYADLVVHRALIRALDLGDGALPP
TETTETLAEVAAQISLTERRAMKAERETVDRLIAHHLADRIGATFQGRVSGVTKAGLFVK
LSDTGADGLIPIRSLGDEYYNYDETRHALIGSRSGAMHRLGDVVDVKLVEAAPVAGALRF
ELIGNANVEFTHRKTARKTKGTSKAKLKTESGKSARAKPGRAKARKAAKPKQKTKSGRGK
R