Protein Info for TX73_016135 in Rhodopseudomonas palustris CGA009

Annotation: DNA-processing protein DprA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF21102: DprA_N" amino acids 1 to 58 (58 residues), 98.2 bits, see alignment E=3.2e-32 TIGR00732: DNA protecting protein DprA" amino acids 60 to 275 (216 residues), 198.4 bits, see alignment E=4.4e-63 PF02481: DNA_processg_A" amino acids 61 to 267 (207 residues), 215 bits, see alignment E=1.1e-67 PF17782: DprA_WH" amino acids 293 to 351 (59 residues), 69.4 bits, see alignment E=3.2e-23

Best Hits

KEGG orthology group: K04096, DNA processing protein (inferred from 99% identity to rpt:Rpal_3531)

Predicted SEED Role

"Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>TX73_016135 DNA-processing protein DprA (Rhodopseudomonas palustris CGA009)
MRLIRAENVGPRTFRSLINHFGSARAALERLPELARRGGAARAGRIPSEDEARREIEAGR
RIGVELVAPGETGYPTRLATIDDAPPLLGVHALPEALAVMARPMIAIVGSRNASGAGLKF
AGQLAADLGAAGFVVISGLARGIDQAAHRASLSSGTVAVLAGGHDKIYPAEHEDLLLDII
QTRGAAISEMPLGHVPRGKDFPRRNRLISGASVGVAVIEAAYRSGSLITARRAADQGREV
FAVPGSPLDPRAAGTNDLIKQGATLITSASDIVEAVASILERPIELPGREPEHAPPEGEP
DTGDRTRILALLGPSPVGIDDLIRLSGISPAVVRTILLELELAGRLERHGGSLVSLS