Protein Info for TX73_016010 in Rhodopseudomonas palustris CGA009

Annotation: ribosome biogenesis GTPase Der

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 TIGR00231: small GTP-binding protein domain" amino acids 4 to 158 (155 residues), 76.3 bits, see alignment E=3.5e-25 amino acids 186 to 355 (170 residues), 94.5 bits, see alignment E=8.7e-31 TIGR03594: ribosome-associated GTPase EngA" amino acids 4 to 445 (442 residues), 557.7 bits, see alignment E=2.9e-171 PF02421: FeoB_N" amino acids 4 to 72 (69 residues), 37.4 bits, see alignment E=1e-12 amino acids 189 to 355 (167 residues), 50 bits, see alignment E=1.4e-16 PF01926: MMR_HSR1" amino acids 5 to 120 (116 residues), 98.1 bits, see alignment E=1.9e-31 amino acids 189 to 307 (119 residues), 93 bits, see alignment E=7.5e-30 PF00025: Arf" amino acids 185 to 356 (172 residues), 26.3 bits, see alignment E=2.7e-09 PF00009: GTP_EFTU" amino acids 188 to 357 (170 residues), 39.4 bits, see alignment E=2.8e-13 PF04548: AIG1" amino acids 189 to 293 (105 residues), 30.7 bits, see alignment E=1.1e-10 PF14714: KH_dom-like" amino acids 365 to 445 (81 residues), 107.6 bits, see alignment E=1.8e-34

Best Hits

Swiss-Prot: 100% identical to DER_RHOPA: GTPase Der (der) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K03977, GTP-binding protein (inferred from 100% identity to rpa:RPA3095)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>TX73_016010 ribosome biogenesis GTPase Der (Rhodopseudomonas palustris CGA009)
MSFTLAIIGRPNVGKSTLFNRLVGQKLALVDDAPGVTRDRREGEGRLGDLNFTLIDTAGL
DEGPKGSLTARMQEQTETAIELADALLFVFDARAGLTPNDRAFADFARRANKPVVLVANK
SEGKSGEIGAMESYALGLGDPVQISAEHGEGMGELYDALRPLLPEPVEDEEDDEPADQSE
EAIATRPIRVAIVGRPNAGKSTFINRLLGEERLLTSPEAGTTRDSIAVEVEWKGRDFRVF
DTAGLRRRSRIEEKLEKLSVADALRAVRFAEVVVLMMDAQNRFEEQDLRIADLVEREGRA
LVIAVNKWDLIERQGGQIAQLRTDADHWLPQIKGVPIVATSGMLGEGVDRLMQAIQDAYA
VWNRRVPTAALNRWFEQAISQNPPPAVSGRRLKLNYVTQTKARPPSFVVFCSRADAVPES
YLRYLVNSLRGAFDLPGTPVRITLREKANPFAHKRKRKS