Protein Info for TX73_015835 in Rhodopseudomonas palustris CGA009

Annotation: LPS export ABC transporter permease LptF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 46 to 74 (29 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 4 to 356 (353 residues), 270.5 bits, see alignment E=8.2e-85 PF03739: LptF_LptG" amino acids 6 to 355 (350 residues), 240.9 bits, see alignment E=1e-75

Best Hits

KEGG orthology group: K07091, lipopolysaccharide export system permease protein (inferred from 100% identity to rpa:RPA3061)

Predicted SEED Role

"FIG000988: Predicted permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>TX73_015835 LPS export ABC transporter permease LptF (Rhodopseudomonas palustris CGA009)
MGSIDRYIFRTTLVSFAVVMGSLTGVIWITQALRGIDLMTSQGQTIITFLGLTGLAVPVL
VLVIAPIALMIAVAHTLNRLATDSEIIVMNAAGLSPIRLFRPFFYATMVVAALVIIIGAY
IAPDGLRRIARWDSEITADVLANVLQPGRFAQLEQGLTIRVRERQPGGLLVGVFIDDARA
PNERVSIIADHGTVVKNDKGSFLVLEDGHLERFQTGKQEPALVAFSRYAFDMSKFSRARD
VAYGIRERYLWELLWPAENDPLLARLPTEFRSEMHDRLLAPIYPFFFAAVAFAFLGLART
TRQSRNFSMAGAVLVAFVVRLAGFALSVIANKTPYVAGLQYLLLFVATGTCLWLINRNVV
IEPPARVTEALNAFNASIARLIRRPVPA