Protein Info for TX73_015585 in Rhodopseudomonas palustris CGA009

Annotation: light-harvesting antenna LH1, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 51 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details PF00556: LHC" amino acids 17 to 50 (34 residues), 38.2 bits, see alignment E=6.8e-14

Best Hits

Swiss-Prot: 100% identical to LHB3_RHOPA: Light-harvesting protein B-800-850 beta chain C (pucBC) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K08939, light-harvesting protein B-800-850 beta chain (inferred from 100% identity to rpt:Rpal_3418)

Predicted SEED Role

"Light-harvesting LHII, beta subunit C" in subsystem Bacterial light-harvesting proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (51 amino acids)

>TX73_015585 light-harvesting antenna LH1, beta subunit (Rhodopseudomonas palustris CGA009)
MVDDSKKVWPTGLTIAESEEIHKHVIDGARIFVAIAIVAHFLAYVYSPWLH