Protein Info for TX73_015555 in Rhodopseudomonas palustris CGA009

Annotation: K(+)-transporting ATPase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00681: K+-transporting ATPase, C subunit
  • amino acids 4 to 197 (194 residues), 212.5 bits, E=2.6e-67
• PF02669: KdpC
  • amino acids 6 to 196 (191 residues), 248 bits, E=2.8e-78

Best Hits

Swiss-Prot: 100% identical to KDPC_RHOPA: Potassium-transporting ATPase KdpC subunit (kdpC) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K01548, K+-transporting ATPase ATPase C chain [EC: 3.6.3.12] (inferred from 100% identity to rpa:RPA3002)

Predicted SEED Role

"Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Protein Sequence (201 amino acids)

>TX73_015555 K(+)-transporting ATPase subunit C (Rhodopseudomonas palustris CGA009)
MLKEVRPAVVSLLALTMITGLAYPLAVTGLATVLFPYQAQGSLVERGGKVVGSALIGQEF
KGDEYFHGRPSATVAPDPADSSKTVSAPYNAANSGGSNLGPTSKALADRLSEDVAKLKAE
NPAAAIPVDLVTTSGSGLDPDISPEGALFQVPRVAKARGVPEEQIRKLVGASINQPLGGV
LGEPRVNVLKLNLALDAAAPR