Protein Info for TX73_015465 in Rhodopseudomonas palustris CGA009

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 227 to 379 (153 residues), 153.1 bits, see alignment E=2.9e-49 PF00990: GGDEF" amino acids 227 to 377 (151 residues), 149.5 bits, see alignment E=3.8e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA2984)

Predicted SEED Role

"Putative Heme-regulated two-component response regulator" in subsystem Putative hemin transporter or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>TX73_015465 GGDEF domain-containing protein (Rhodopseudomonas palustris CGA009)
MPGSVVRVTLSLIGPGIIGVFGVAFLAAWSYDRRRPYLALLAAACALFALGASSQILYWP
RDTGLNAMVSGALYTCAVIAAVEGVLIRSSRAFGLWIDVAIFAAFSLALYYFFYVDRSLL
ARIYVQNFGYGLLLCVAALRLAHLRHGRVVDRILFWTLLLFGLHFFPRTVFTVGVSPPSG
GPLVFADSVFWQTLQLSLAVLGAALAMAILAAAVSDLIDDLRRERDLDHLTGLLNRRGFE
EEIAAPMRRAPEGASLILCDVDHFKSINDTFGHDVGDVVLKEIGAILRKTARKGDLVGRW
GGEEFAVFLPDASLSDATECAERLRQTIANSRIPGLDTRPVTASFGVATIREAGDWTALY
KLADSRLYLAKASGRDRTVDRGM