Protein Info for TX73_015415 in Rhodopseudomonas palustris CGA009

Annotation: 8-amino-7-oxononanoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 39% identical to BIOF_BACLD: Putative 8-amino-7-oxononanoate synthase (bioF) from Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)

KEGG orthology group: K00652, 8-amino-7-oxononanoate synthase [EC: 2.3.1.47] (inferred from 100% identity to rpa:RPA2972)

MetaCyc: 59% identical to 8-amino-7-oxononanoate synthase (Agrobacterium fabrum C58)
8-amino-7-oxononanoate synthase. [EC: 2.3.1.47]

Predicted SEED Role

"8-amino-7-oxononanoate synthase (EC 2.3.1.47)" in subsystem Biotin biosynthesis (EC 2.3.1.47)

MetaCyc Pathways

biotin biosynthesis I (13/15 steps found)
8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
biotin biosynthesis II (4/6 steps found)
8-amino-7-oxononanoate biosynthesis II (1/2 steps found)
8-amino-7-oxononanoate biosynthesis III (1/2 steps found)

KEGG Metabolic Maps

Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>TX73_015415 8-amino-7-oxononanoate synthase (Rhodopseudomonas palustris CGA009)
MYQSLEADLRSLADAGRRRKLQPRAGVDFTSNDYLGLAESDELRQAAANAVARGVPIGAG
GSRLLRGNHEEHEALEAEAADYFGAESALYLGGGFSANHAIFATLPQRGDLVLYDELIHA
SVHEGMRRGRATCESVPHSDIDAFDARLRQWRASGGRGRAWIAVESVYSMDGDSPRLDEL
VAVADRHDAILVIDEAHATGVAGPEGRGLAASFEGRANVITLHTCGKALGTMGGFVLGPK
IVRDFLVNRARPFIFATAPSPLIAAVTRAALDISRTRPERRERLAALVAFADRELKQRCG
ITSSGSHILPIIVGANSTAVALAASLQRRGFDVRAIRPPTVPEGTARLRIALSANLSEDV
IASLFAALAEDMRAAA