Protein Info for TX73_015320 in Rhodopseudomonas palustris CGA009

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 22 to 23 (2 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 45 to 383 (339 residues), 249.8 bits, see alignment E=1.7e-78 PF16576: HlyD_D23" amino acids 72 to 230 (159 residues), 40.3 bits, see alignment E=2.3e-14 amino acids 251 to 303 (53 residues), 33.3 bits, see alignment 3.2e-12 PF13437: HlyD_3" amino acids 180 to 300 (121 residues), 35.5 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA2955)

Predicted SEED Role

"Possible RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>TX73_015320 efflux RND transporter periplasmic adaptor subunit (Rhodopseudomonas palustris CGA009)
MICARLASLASARRIGIVALIAGAPIILTGCKEQNKYAAPPPAKVTVAKPTQAPVTLYAE
FTGNTSPVASVDLEARVQGFLESVDYLDGEAVKKDRELFKIEKAQYQAQVDLQQAQLDGA
KAKQANAQREADRQTILGQRDVASQRNVDDAQTNLAAANAQVAAAQASLALAKTSLGYTT
VTAPFDGVVTRRLVNVGTLVGSAGPTKLATILQVDPLYVYFNITEQQQINLRDALAKRGK
TLKDMREERLEMPIQVALASDTSFQYAGKIDYIAPQVDPSTGTLQLRGTLPNKDVALVPG
LFVRVRVAVGQLDDALLINDTAVMSNQTGSYVMVVGAGDVVEQRQVTLGPQEGQLRVVTS
GLKADDRVVIGAIQRAIAGNTVTPVAGTMAAAPTAPTPAPAALSPGAQSGTAKP