Protein Info for TX73_015290 in Rhodopseudomonas palustris CGA009

Annotation: NADH-quinone oxidoreductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01957: NADH-quinone oxidoreductase, B subunit
  • amino acids 51 to 192 (142 residues), 235.9 bits, E=7.3e-75
• PF01058: Oxidored_q6
  • amino acids 77 to 184 (108 residues), 99.5 bits, E=6e-33

Best Hits

Swiss-Prot: 100% identical to NUOB1_RHOPT: NADH-quinone oxidoreductase subunit B 1 (nuoB1) from Rhodopseudomonas palustris (strain TIE-1)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 100% identity to rpa:RPA2951)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (198 amino acids)

>TX73_015290 NADH-quinone oxidoreductase subunit B (Rhodopseudomonas palustris CGA009)
MQPTPSQHPVGAQPLIARPATGIIDPNTGRPVGADDPFFLNVNRELSDKGFFVAATDDLI
TWARTGSLMWMTFGLACCAVEMMQLSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMA
PALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPIDIYVPGCPPTAEALL
YGVMLLQKKIRRTGTIER