Protein Info for TX73_015245 in Rhodopseudomonas palustris CGA009

Annotation: NADH-quinone oxidoreductase subunit NuoI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01971: NADH-quinone oxidoreductase, chain I
  • amino acids 19 to 140 (122 residues), 160.4 bits, E=6.4e-52
• PF13237: Fer4_10
  • amino acids 59 to 113 (55 residues), 27.3 bits, E=1.6e-09
• PF00037: Fer4
  • amino acids 59 to 78 (20 residues), 25.8 bits, see alignment (E = 3.9e-09)
  • amino acids 96 to 117 (22 residues), 31.3 bits, see alignment (E = 7.2e-11)
• PF12800: Fer4_4
  • amino acids 60 to 74 (15 residues), 17.2 bits, see alignment (E = 3e-06)
  • amino acids 101 to 114 (14 residues), 12.5 bits, see alignment (E = 9.7e-05)
• PF12838: Fer4_7
  • amino acids 61 to 116 (56 residues), 47.4 bits, E=1.2e-15
• PF13187: Fer4_9
  • amino acids 61 to 117 (57 residues), 36.7 bits, E=1.9e-12

Best Hits

Swiss-Prot: 100% identical to NUOI1_RHOPA: NADH-quinone oxidoreductase subunit I 1 (nuoI1) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 99% identity to rpx:Rpdx1_2561)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (162 amino acids)

>TX73_015245 NADH-quinone oxidoreductase subunit NuoI (Rhodopseudomonas palustris CGA009)
MNVTATARSLLLTEFVSAFFLAMRYFFKPKPTINYPFEKNPISPRFRGEHALRRYPNGEE
RCIACKLCEAVCPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGFCQEACPVDAIVEG
PNFEFATETREELYYDKARLLANGDRWEREIAKAISLDAPYR