Protein Info for TX73_015180 in Rhodopseudomonas palustris CGA009

Annotation: CopD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 151 to 171 (21 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details PF04234: CopC" amino acids 33 to 123 (91 residues), 73.3 bits, see alignment E=2.6e-24 PF05425: CopD" amino acids 314 to 412 (99 residues), 86.6 bits, see alignment E=1.4e-28

Best Hits

KEGG orthology group: K14166, copper transport protein (inferred from 100% identity to rpa:RPA2929)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>TX73_015180 CopD family protein (Rhodopseudomonas palustris CGA009)
MTALRHRMRSRGRWLAWITAIVVVLWPALAAAHASLVASDPASEAVLATSPTTFSLTFNE
PVTALLLQLIDARGRSQAITAIDQDGATLRFAPPALLSEGAHVLSWRVISADGHPIGGAL
TFWIGTPGQRLPPIVVPDDPVRRAAIWGTRITVDFTLLTAVGGAVFLGWIATVPVAGMMT
AGLALLGLAAVVLSAGLQGLDALDLPLARLGDAAVWRAGASGSFGDAATLSGLALVLALA
ALRWRGWNARLLSLGAVVSLGTAFAVSGHAATAEPRSLSGAAVWVHGVSLALWIGALLPL
AIAVGRRDAAPAPLRRFSKAIPLAIVALLISGIALAAIELGRIDALWQSDYGRVLIAKLA
LVVVLLALALWNRVRLTPLLLAGEATAVRRMRASIAAELVLVIAILGVVGLWRFTPPPRS
AVSQSTAPSEVVHLHTERAMATVTLAPARAGPVEIEVLLQTADEALLAAQALTVTLANPA
AGIEPLSAEARKTADGPWRARLTAPVPGTWTLTLGILISDFEKVNLEAPIVIR