Protein Info for TX73_015100 in Rhodopseudomonas palustris CGA009

Annotation: outer membrane protein assembly factor BamA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 841 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details TIGR03303: outer membrane protein assembly complex, YaeT protein" amino acids 42 to 841 (800 residues), 728.3 bits, see alignment E=5.8e-223 PF07244: POTRA" amino acids 107 to 184 (78 residues), 57.9 bits, see alignment E=2.1e-19 amino acids 189 to 275 (87 residues), 55.5 bits, see alignment E=1.1e-18 amino acids 278 to 357 (80 residues), 46.6 bits, see alignment E=6.9e-16 amino acids 360 to 433 (74 residues), 55.2 bits, see alignment E=1.4e-18 PF01103: Omp85" amino acids 460 to 841 (382 residues), 287.7 bits, see alignment E=2.4e-89

Best Hits

KEGG orthology group: K07277, outer membrane protein (inferred from 100% identity to rpt:Rpal_3260)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (841 amino acids)

>TX73_015100 outer membrane protein assembly factor BamA (Rhodopseudomonas palustris CGA009)
MKVGMRVLRGVVGAALVFFAVPVATTAVGVVMASPAAAQSASSIAVEGNRRVEAETIRSY
FKPGPGGRLDQGSIDDGLKALIETGLFQDVRINQAGGRLVVSVVENPVIGRLAFEGNKKI
KDEQLSAEIQSKPRGTLSRPMVQGDALRIAEIYRRSGRYDVRVDPQIIEQPNNRVDLVFV
ITEGPKTGVKSIEFVGNKAYSSYRLKDVIKTRESNLLSFLGNGDVYDPDRVEADRDLIRR
FYLKHGFADVQVVAALTEYDPERKGFLVTFKIEEGQQYRVGSVTFESAIPTLDGNSMRSF
SRVNVGSLYNAEALEKSVEEMQIELSRRGYAFATVRPRGDRNFDEHTVSIVFSIEEGPRV
YIERINVVGNTRTRDYVIRREFDISEGDAYNRALVDRAERRLKNLDFFKTVKITTEPGSS
SDRVILVVNLEEKSTGDFSVSGGYSTSDGALGEVSVSERNFLGRGIFAKASVQYGQYARG
YSLSFVEPYLLDYRVALGLDLYQREQLANRYISYSTKTLGFSPRLGFALREDLSLQIRYS
LYRQEITLPSYLNNCNNIPGPGFFPTPQYIAANNLQATYGVLGCYGDGEASLPVRIGLAG
GAYWTSSLGYTLTYNTLDNIKNPTDGLLVDLRQDFAGVGGDVKFIKTAFDAKYYTSLVSD
LVGLIHLQAGNLSTYGDNQLRMLDHFQMGSNLVRGFAPNGIGPRDIGQYALYGYGGDALG
GTNYWGASVELQMPFWFLPKEVGLKGAVYADAGSLFDYKGPTSWSVTGEVNTPGCIPASQ
TTIGTCSGLNYDDTNLVRTSVGVGLIWASPFGPLRFDYAIPITKGKYDRVQEFKFGGGTS
F