Protein Info for TX73_014990 in Rhodopseudomonas palustris CGA009

Annotation: cyclic pyranopterin monophosphate synthase MoaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00581: molybdenum cofactor biosynthesis protein C
  • amino acids 18 to 166 (149 residues), 196.9 bits, E=7.5e-63
• PF01967: MoaC
  • amino acids 29 to 164 (136 residues), 188.7 bits, E=2.4e-60

Best Hits

Swiss-Prot: 80% identical to MOAC_BRADU: Cyclic pyranopterin monophosphate synthase (moaC) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 100% identity to rpa:RPA2892)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

Protein Sequence (176 amino acids)

>TX73_014990 cyclic pyranopterin monophosphate synthase MoaC (Rhodopseudomonas palustris CGA009)
MAKTAKSTSKPEATPPALTHIGASGEARMVDVSEKPATERVAVAEGRVVMKKATLELILS
GDAKKGDVLGTARVAGIMAAKRTADLIPLCHPLALSKVTLDITPDAKLPGCIVRATVKVT
GPTGVEMEALTAVSVACLTIYDMIKAAERGVRIEGIHLIAKTGGKSGDYVASASRK