Protein Info for TX73_014985 in Rhodopseudomonas palustris CGA009

Annotation: indole-3-glycerol phosphate synthase TrpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00218: IGPS
  • amino acids 5 to 260 (256 residues), 326.6 bits, E=4.4e-102

Best Hits

Swiss-Prot: 99% identical to TRPC_RHOPT: Indole-3-glycerol phosphate synthase (trpC) from Rhodopseudomonas palustris (strain TIE-1)

KEGG orthology group: K01609, indole-3-glycerol phosphate synthase [EC: 4.1.1.48] (inferred from 100% identity to rpa:RPA2891)

MetaCyc: 36% identical to indole-3-glycerol phosphate synthase (Thermococcus kodakarensis)
Indole-3-glycerol-phosphate synthase. [EC: 4.1.1.48]

Predicted SEED Role

"Indole-3-glycerol phosphate synthase (EC 4.1.1.48)" in subsystem Tryptophan synthesis (EC 4.1.1.48)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of chorismate metabolism (40/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.48

Protein Sequence (265 amino acids)

>TX73_014985 indole-3-glycerol phosphate synthase TrpC (Rhodopseudomonas palustris CGA009)
MSDILTKIEAYKREEIAAAKRERPLAAIEAIAREASPPRGFVKALRAKHAAGDYGLIAEI
KKASPSKGLIRADFDPPALARAYEAGGAACLSVLTDTPSFQGSLDYLVAARAAVSLPALR
KDFMYDTYQVVEARAHGADCILIIMAALDDAEAKDIEDAAFDLGMDVLLEVHDAPELERA
LKLRSPMVGVNNRNLRSFEVTLATSEALAPLIPKDRLMVGESGIFTPADLARLARVGMST
FLVGESLMRQQDVTAATRALLARAA